HPA002920

PSMD10 antibody from Atlas Antibodies
p28
Validated within the Antibodypedia Validation Initative

Antibody data

Product number
HPA002920
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA002920, RRID:AB_611729
Product name
Anti-PSMD10
Provider product page
Atlas Antibodies - HPA002920
Antibody type
Polyclonal
Description
Affinity purified using the PrEST antigen as affinity ligand
Reactivity
Human, Mouse, Rat
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
EGCVSNLMVCNLAYSGKLEELKESILADKSLATRT
DQDSRTALHWACSAGHTEIVEFLLQLGVPVNDKDD
AGWSPLHIAASAGRDEIVKALLGKGAQVNAVNQNG
CTPL
Isotype
IgG
Vial size
100 µl
Storage
Store at +4¡C for short term storage. Long time storage is recommended at -20¡C.
Provider Type Product Number
- No reagents -