HPA002920

PSMD10 antibody from Sigma-Aldrich
p28
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA002920
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA002920, RRID:AB_1079708
Product name
Anti-PSMD10 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA002920
Antibody type
Polyclonal
Antigen
26S proteasome non-ATPase regulatory subunit 10 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
EGCVSNLMVCNLAYSGKLEELKESILADKSLATRT
DQDSRTALHWACSAGHTEIVEFLLQLGVPVNDKDD
AGWSPLHIAASAGRDEIVKALLGKGAQVNAVNQNG
CTPL
Storage
-20C
Provider Type Product Number
- No reagents -