HPA001521

ZNF350 antibody from Atlas Antibodies
ZBRK1, ZFQR
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA001521
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA001521, RRID:AB_1080705
Product name
Anti-ZNF350
Provider product page
Atlas Antibodies - HPA001521
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
FKLEQGEQLWTIEDGIHSGACSDIWKVDHVLERLQ
SESLVNRRKPCHEHDAFENIVHCSKSQFLLGQNHD
IFDLRGKSLKSNLTLVNQSKGYEIKNSVEFTGNGD
SFLHANHERLHTAIKFPASQ
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -