HPA028624

C1orf213 antibody from MilliporeSigma / Merck KGaA
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA028624
Provider
MilliporeSigma / Merck KGaA
Proper citation
Sigma-Aldrich Cat#HPA028624, RRID:AB_10599971
Product name
Anti-C1orf213 antibody produced in rabbit
Provider product page
MilliporeSigma / Merck KGaA - HPA028624
Antibody type
Polyclonal
Antigen
Putative uncharacterized protein C1orf213 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
VPEVSDPQVDLEFVDLQAKPRYRRLILKTQIPEAS
DSQAAQKPQAHRQIPETTEAGRETTSN
Storage
-20C
Provider Type Product Number
- No reagents -