Antibody data
- Antibody Data
- Antigen structure
- References [11]
- Comments [0]
- Validations
- Immunocytochemistry [1]
- Immunohistochemistry [7]
Submit
Validation data
Reference
Comment
Report error
- Product number
- HPA002877 - Provider product page
- Provider
- Atlas Antibodies
- Proper citation
- Atlas Antibodies Cat#HPA002877, RRID:AB_1079602
- Product name
- Anti-PGRMC1
- Antibody type
- Polyclonal
- Reactivity
- Human, Mouse, Rat
- Host
- Rabbit
- Conjugate
- Unconjugated
- Antigen sequence
DQPAASGDSDDDEPPPLPRLKRRDFTPAELRRFDG
VQDPRILMAINGKVFDVTKGRKFYGPEGPYGVFAG
RDASR- Isotype
- IgG
- Vial size
- 100 µl
- Storage
- Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Submitted references Triple-responsive expansile nanogel for tumor and mitochondria targeted photosensitizer delivery.
Progesterone receptor membrane component 1 as the mediator of the inhibitory effect of progestins on cytokine-induced matrix metalloproteinase 9 activity in vitro.
Progesterone antagonism of neurite outgrowth depends on microglial activation via Pgrmc1/S2R.
Plasminogen activator inhibitor 1 RNA-binding protein interacts with progesterone receptor membrane component 1 to regulate progesterone's ability to maintain the viability of spontaneously immortalized granulosa cells and rat granulosa cells.
Proteome-wide mapping of cholesterol-interacting proteins in mammalian cells
Differential responses of progesterone receptor membrane component-1 (Pgrmc1) and the classical progesterone receptor (Pgr) to 17β-estradiol and progesterone in hippocampal subregions that support synaptic remodeling and neurogenesis.
Evidence for a genomic mechanism of action for progesterone receptor membrane component-1.
Progesterone regulation of progesterone receptor membrane component 1 (PGRMC1) sumoylation and transcriptional activity in spontaneously immortalized granulosa cells.
Expression of progesterone receptor membrane component-1 in bovine reproductive system during estrous cycle.
Progesterone inhibits apoptosis in part by PGRMC1-regulated gene expression.
Progesterone stimulates the proliferation of female and male cholangiocytes via autocrine/paracrine mechanisms
He H, Cattran AW, Nguyen T, Nieminen AL, Xu P
Biomaterials 2014 Nov;35(35):9546-53
Biomaterials 2014 Nov;35(35):9546-53
Progesterone receptor membrane component 1 as the mediator of the inhibitory effect of progestins on cytokine-induced matrix metalloproteinase 9 activity in vitro.
Allen TK, Feng L, Grotegut CA, Murtha AP
Reproductive sciences (Thousand Oaks, Calif.) 2014 Feb;21(2):260-8
Reproductive sciences (Thousand Oaks, Calif.) 2014 Feb;21(2):260-8
Progesterone antagonism of neurite outgrowth depends on microglial activation via Pgrmc1/S2R.
Bali N, Arimoto JM, Morgan TE, Finch CE
Endocrinology 2013 Jul;154(7):2468-80
Endocrinology 2013 Jul;154(7):2468-80
Plasminogen activator inhibitor 1 RNA-binding protein interacts with progesterone receptor membrane component 1 to regulate progesterone's ability to maintain the viability of spontaneously immortalized granulosa cells and rat granulosa cells.
Peluso JJ, Yuan A, Liu X, Lodde V
Biology of reproduction 2013 Jan;88(1):20
Biology of reproduction 2013 Jan;88(1):20
Proteome-wide mapping of cholesterol-interacting proteins in mammalian cells
Hulce J, Cognetta A, Niphakis M, Tully S, Cravatt B
Nature Methods 2013 February;10(3):259-264
Nature Methods 2013 February;10(3):259-264
Differential responses of progesterone receptor membrane component-1 (Pgrmc1) and the classical progesterone receptor (Pgr) to 17β-estradiol and progesterone in hippocampal subregions that support synaptic remodeling and neurogenesis.
Bali N, Arimoto JM, Iwata N, Lin SW, Zhao L, Brinton RD, Morgan TE, Finch CE
Endocrinology 2012 Feb;153(2):759-69
Endocrinology 2012 Feb;153(2):759-69
Evidence for a genomic mechanism of action for progesterone receptor membrane component-1.
Peluso JJ, DeCerbo J, Lodde V
Steroids 2012 Aug;77(10):1007-12
Steroids 2012 Aug;77(10):1007-12
Progesterone regulation of progesterone receptor membrane component 1 (PGRMC1) sumoylation and transcriptional activity in spontaneously immortalized granulosa cells.
Peluso JJ, Lodde V, Liu X
Endocrinology 2012 Aug;153(8):3929-39
Endocrinology 2012 Aug;153(8):3929-39
Expression of progesterone receptor membrane component-1 in bovine reproductive system during estrous cycle.
Luciano AM, Corbani D, Lodde V, Tessaro I, Franciosi F, Peluso JJ, Modina S
European journal of histochemistry : EJH 2011;55(3):e27
European journal of histochemistry : EJH 2011;55(3):e27
Progesterone inhibits apoptosis in part by PGRMC1-regulated gene expression.
Peluso JJ, Liu X, Gawkowska A, Lodde V, Wu CA
Molecular and cellular endocrinology 2010 May 14;320(1-2):153-61
Molecular and cellular endocrinology 2010 May 14;320(1-2):153-61
Progesterone stimulates the proliferation of female and male cholangiocytes via autocrine/paracrine mechanisms
Glaser S, DeMorrow S, Francis H, Ueno Y, Gaudio E, Vaculin S, Venter J, Franchitto A, Onori P, Vaculin B, Marzioni M, Wise C, Pilanthananond M, Savage J, Pierce L, Mancinelli R, Alpini G
AJP: Gastrointestinal and Liver Physiology 2008 May;295(1)
AJP: Gastrointestinal and Liver Physiology 2008 May;295(1)
No comments: Submit comment
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunofluorescent staining of human cell line U-251 MG shows localization to nucleoli & endoplasmic reticulum.
- Sample type
- HUMAN
Enhanced validation
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Enhanced method
- Orthogonal validation
- Main image
- Experimental details
- Immunohistochemistry analysis in human liver and skeletal muscle tissues using HPA002877 antibody. Corresponding PGRMC1 RNA-seq data are presented for the same tissues.
- Sample type
- HUMAN
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human liver shows strong cytoplasmic positivity in hepatocytes.
- Sample type
- HUMAN
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human kidney shows moderate to strong cytoplasmic positivity in cells in tubules.
- Sample type
- HUMAN
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human breast cancer shows strong cytoplasmic positivity in tumor cells.
- Sample type
- HUMAN
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human endometrium shows moderate to strong cytoplasmic positivity in glandular and stromal cells.
- Sample type
- HUMAN
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human hippocampus shows strong cytoplasmic positivity in neuronal cells.
- Sample type
- HUMAN
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human skeletal muscle shows no cytoplasmic positivity in myocytes as expected.
- Sample type
- HUMAN