HPA002877

PGRMC1 antibody from Sigma-Aldrich
HPR6.6
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA002877
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA002877, RRID:AB_1079602
Product name
Anti-PGRMC1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA002877
Antibody type
Polyclonal
Antigen
Membrane-associated progesterone receptor component 1 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
DQPAASGDSDDDEPPPLPRLKRRDFTPAELRRFDG
VQDPRILMAINGKVFDVTKGRKFYGPEGPYGVFAG
RDASR
Storage
-20C
Provider Type Product Number
- No reagents -