HPA018487

PCGF3 antibody from Sigma-Aldrich
DONG1, FLJ36550, MGC40413, RNF3, RNF3A
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA018487
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA018487, RRID:AB_1856359
Product name
Anti-PCGF3 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA018487
Antibody type
Polyclonal
Antigen
Polycomb group RING finger protein 3 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
LVKYLEENNTCPTCRIVIHQSHPLQYIGHDRTMQD
IVYKLVPGLQEAEMRKQREFYHKLGMEVPGDIKGE
TCSAKQHLDSHRNGETKADD
Storage
-20C
Provider Type Product Number
- No reagents -