HPA027018

VN1R4 antibody from Sigma-Aldrich
V1RL4
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA027018
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA027018, RRID:AB_10603142
Product name
Anti-VN1R4 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA027018
Antibody type
Polyclonal
Antigen
vomeronasal 1 receptor 4 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
TGKWNYTNITVNEDLGYCSGGGNNKIAQTLRAMLL
Storage
-20C
Provider Type Product Number
- No reagents -