HPA023919

ARHGAP27 antibody from Sigma-Aldrich
CAMGAP1, FLJ43547, SH3D20, SH3P20
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA023919
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA023919, RRID:AB_2059402
Product name
Anti-ARHGAP27 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA023919
Antibody type
Polyclonal
Antigen
Rho GTPase-activating protein 27 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
WTVLEGGVLTFFKDSKTSAAGGLRQPSKFSTPEYT
VELRGATLSWAPKDKSSRKNVLELRSRDGSEYLIQ
HDSEAIISTWHKAIAQGIQE
Storage
-20C
Provider Type Product Number
- No reagents -