Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN183065 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-Midline 1 (MID1) (C-Term) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-MID1 antibody: synthetic peptide directed towards the C terminal of human MID1
- Description
- Protein A purified
- Reactivity
- Human, Mouse, Rat, Bovine, Canine, Chicken/Avian, Xenopus, Zebrafish
- Host
- Rabbit
- Antigen sequence
AINQAGSRSSEPGKLKTNSQPFKLDPKSAHRKLKV
SHDNL TVERDESSSK- Epitope
- C-Term
- Vial size
- 100 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references Regulation of the MID1 protein function is fine-tuned by a complex pattern of alternative splicing.
Winter J, Lehmann T, Krauss S, Trockenbacher A, Kijas Z, Foerster J, Suckow V, Yaspo ML, Kulozik A, Kalscheuer V, Schneider R, Schweiger S
Human genetics 2004 May;114(6):541-52
Human genetics 2004 May;114(6):541-52
No comments: Submit comment
No validations: Submit validation data