Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- HPA003715 - Provider product page
- Provider
- Atlas Antibodies
- Product name
- Anti-MID1
- Antibody type
- Polyclonal
- Antigen
- Recombinant protein fragment
- Description
- Affinity purified using the antigen as affinity ligand.
- Reactivity
- Human
- Host
- Rabbit
- Antigen sequence
GKLKTNSQPFKLDPKSAHRKLKVSHDNLTVERDES
SSKKSHTPERFTSQGSYGVAGNVFIDSGRHYWEVV
ISGSTWYAIGLAYKSAPKHEWIGKNSASWALCRCN
NNWVVRHNSKEIPIEPAPHLRRVGILLDYDNGSIA
FYDALNS- Isotype
- IgG
- Vial size
- 110µl
- Concentration
- 0.13 mg/ml
- Storage
- For continuous use, store at 2-8°C for one-two days. For extended storage, store in -20°C freezer. Working dilution samples should be discarded if not used within 12 hours.
- Handling
- The antibody solution should be gently mixed before use.
Submitted references Protein phosphatase 2A (PP2A)-specific ubiquitin ligase MID1 is a sequence-dependent regulator of translation efficiency controlling 3-phosphoinositide-dependent protein kinase-1 (PDPK-1).
Aranda-Orgillés B, Rutschow D, Zeller R, Karagiannidis AI, Köhler A, Chen C, Wilson T, Krause S, Roepcke S, Lilley D, Schneider R, Schweiger S
The Journal of biological chemistry 2011 Nov 18;286(46):39945-57
The Journal of biological chemistry 2011 Nov 18;286(46):39945-57
No comments: Submit comment
No validations: Submit validation data