HPA003715

MID1 antibody from Sigma-Aldrich
FXY, OS, RNF59, TRIM18
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA003715
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA003715, RRID:AB_1079384
Product name
Anti-MID1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA003715
Antibody type
Polyclonal
Antigen
Midline-1 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
GKLKTNSQPFKLDPKSAHRKLKVSHDNLTVERDES
SSKKSHTPERFTSQGSYGVAGNVFIDSGRHYWEVV
ISGSTWYAIGLAYKSAPKHEWIGKNSASWALCRCN
NNWVVRHNSKEIPIEPAPHLRRVGILLDYDNGSIA
FYDALNS
Storage
-20C
Provider Type Product Number
- No reagents -