H00079783-M01

SUGCT antibody from Abnova Corporation
C7orf10, DERP13, FLJ11808, ORF19

Antibody data

Product number
H00079783-M01
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00079783-M01, RRID:AB_1137114
Product name
C7orf10 monoclonal antibody (M01), clone 2B11
Provider product page
Abnova Corporation - H00079783-M01
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a partial recombinant C7orf10.
Antigen sequence
AVSGFQSLLHSLAHGPFLHLQGSARVLHNGLVMEM
EHPTVGKISVPGPAVRYSKFKMSEARPPPLLGQHT
THILKEVLRYDDRAIGELLSAGVVDQHETH
Isotype
IgG
Antibody clone number
2B11
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -