PAB20913

C21orf62 antibody from Abnova Corporation
B37, C21orf120, PRED81

Antibody data

Product number
PAB20913
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#PAB20913, RRID:AB_10963300
Product name
C21orf62 polyclonal antibody
Provider product page
Abnova Corporation - PAB20913
Antibody type
Polyclonal
Description
Rabbit polyclonal antibody raised against recombinant C21orf62.
Antigen sequence
TLVQDLKLSLCSTNTLPTEYLAICGLKRLRINMEA
KHPFPEQSLLIHSGGDSDSREKPMWLHKGWQPCMY
ISFLD
Isotype
IgG
Storage
Store at 4°C. For long term storage store at -20°C.Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -