Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN405771 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-Chromosome 21 Open Reading Frame 62 (C21orf62) (Middle Region) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-C21orf62 antibody: synthetic peptide directed towards the middle region of human C21orf62
- Description
- Affinity Purified
- Reactivity
- Human
- Host
- Rabbit
- Antigen sequence
STNTLPTEYLAICGLKRLRINMEAKHPFPEQSLLI
HSGGD SDSREKPMWL- Epitope
- Middle Region
- Vial size
- 50 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references Prominent use of distal 5' transcription start sites and discovery of a large number of additional exons in ENCODE regions.
Denoeud F, Kapranov P, Ucla C, Frankish A, Castelo R, Drenkow J, Lagarde J, Alioto T, Manzano C, Chrast J, Dike S, Wyss C, Henrichsen CN, Holroyd N, Dickson MC, Taylor R, Hance Z, Foissac S, Myers RM, Rogers J, Hubbard T, Harrow J, Guigó R, Gingeras TR, Antonarakis SE, Reymond A
Genome research 2007 Jun;17(6):746-59
Genome research 2007 Jun;17(6):746-59
No comments: Submit comment
No validations: Submit validation data