ABIN405771

C21orf62 antibody from antibodies-online
B37, C21orf120, PRED81

Antibody data

Product number
ABIN405771
Provider
antibodies-online
Product name
anti-Chromosome 21 Open Reading Frame 62 (C21orf62) (Middle Region) antibody
Provider product page
antibodies-online - ABIN405771
Antibody type
Polyclonal
Antigen
The immunogen for anti-C21orf62 antibody: synthetic peptide directed towards the middle region of human C21orf62
Description
Affinity Purified
Reactivity
Human
Host
Rabbit
Antigen sequence
STNTLPTEYLAICGLKRLRINMEAKHPFPEQSLLI
HSGGD SDSREKPMWL
Epitope
Middle Region
Vial size
50 μg
Concentration
1mg/mL
Storage
-20°C
Handling
Avoid repeated freeze-thaw cycles.
Provider Type Product Number
- No reagents -