HPA016899

C21orf62 antibody from Sigma-Aldrich
B37, C21orf120, PRED81
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA016899
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA016899, RRID:AB_1845704
Product name
Anti-C21orf62 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA016899
Antibody type
Polyclonal
Antigen
Uncharacterized protein C21orf62 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
TLVQDLKLSLCSTNTLPTEYLAICGLKRLRINMEA
KHPFPEQSLLIHSGGDSDSREKPMWLHKGWQPCMY
ISFLD
Storage
-20C
Provider Type Product Number
- No reagents -