HPA016899

C21orf62 antibody from Atlas Antibodies
B37, C21orf120, PRED81
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA016899
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA016899, RRID:AB_1845704
Product name
Anti-C21orf62
Provider product page
Atlas Antibodies - HPA016899
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
TLVQDLKLSLCSTNTLPTEYLAICGLKRLRINMEA
KHPFPEQSLLIHSGGDSDSREKPMWLHKGWQPCMY
ISFLD
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -