Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Immunohistochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- PAB28136 - Provider product page

- Provider
- Abnova Corporation
- Product name
- SLC25A41 polyclonal antibody
- Antibody type
- Polyclonal
- Description
- Rabbit polyclonal antibody raised against recombinant SLC25A41.
- Antigen sequence
AQDTVEGSNPTMRGVLQRILAQQGWLGLYRG- Isotype
- IgG
- Storage
- Store at 4°C. For long term storage store at -20°C.Aliquot to avoid repeated freezing and thawing.
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Immunohistochemical staining of human liver with SLC25A41 polyclonal antibody (Cat # PAB28136) shows moderate cytoplasmic and nuclear positivity in hepatocytes at 1:50-1:200 dilution.
- Validation comment
- Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)