HPA005546

DLGAP5 antibody from Atlas Antibodies
DLG1, DLG7, HURP, KIAA0008

Antibody data

Product number
HPA005546
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA005546, RRID:AB_1078677
Product name
Anti-DLGAP5
Provider product page
Atlas Antibodies - HPA005546
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
ASRHRKDISTEMIRTKIAHRKSLSQKENRHKEYER
NRHFGLKDVNIPTLEGRILVELDETSQGLVPEKTN
VKPRAMKTILGDQRKQMLQKYKEEKQLQKLKEQRE
KAKRGIFKVGRYRPDMPCFLLSNQNAVKAE
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.