HPA005546

DLGAP5 antibody from Sigma-Aldrich
DLG1, DLG7, HURP, KIAA0008
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA005546
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA005546, RRID:AB_1078677
Product name
Anti-DLGAP5 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA005546
Antibody type
Polyclonal
Antigen
Discs large homolog 7 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
ASRHRKDISTEMIRTKIAHRKSLSQKENRHKEYER
NRHFGLKDVNIPTLEGRILVELDETSQGLVPEKTN
VKPRAMKTILGDQRKQMLQKYKEEKQLQKLKEQRE
KAKRGIFKVGRYRPDMPCFLLSNQNAVKAE
Storage
-20C
Provider Type Product Number
- No reagents -