HPA006034

PPP2R5E antibody from Sigma-Aldrich
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA006034
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA006034, RRID:AB_1079670
Product name
Anti-PPP2R5E antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA006034
Antibody type
Polyclonal
Antigen
Serine/threonine-protein phosphatase 2A 56 kDa regulatory subunit epsilon-isoform recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
MSSAPTTPPSVDKVDGFSRKSVRKARQKRSQSSSQ
FRSQGKPIELTPLPLLKDVPSSEQPELFLKKLQQC
CVIFDFMDTLSDLKMKEYKRSTLNELVDYITISRG
CLTEQTYPEVVRMVSCNIFRTLPPSDSNEFDPEED
EPTLEASWPH
Storage
-20C
Provider Type Product Number
- No reagents -