HPA002857

STAG2 antibody from Sigma-Aldrich
SA-2, SA2, SCC3B
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA002857
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA002857, RRID:AB_1079861
Product name
Anti-STAG2 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA002857
Antibody type
Polyclonal
Antigen
Cohesin subunit SA-2 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
LTAKEKKTQLDDRTKITELFAVALPQLLAKYSVDA
EKVTNLLQLPQYFDLEIYTTGRLEKHLDALLRQIR
NIVEKHTDTDVLEACSKTYHALCNEEFTIFNRVDI
SRSQLIDELADKFNRLLEDFLQEGE
Storage
-20C
Provider Type Product Number
- No reagents -