HPA029467

DENND11 antibody from MilliporeSigma / Merck KGaA
KIAA1147, LCHN
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA029467
Provider
MilliporeSigma / Merck KGaA
Proper citation
Sigma-Aldrich Cat#HPA029467, RRID:AB_10602915
Product name
Anti-KIAA1147 antibody produced in rabbit
Provider product page
MilliporeSigma / Merck KGaA - HPA029467
Antibody type
Polyclonal
Antigen
KIAA1147 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
QSDFIYFRKGPFFGLACFANMPVESELERGARMKS
VGILSPSYTLLYRYMHFLENQVRHQLEMPGHYSHL
AAFYEDKKGVLHAGPGRGSSLPPVYWLPSIHRYMY
PEMKITHP
Storage
-20C
Provider Type Product Number
- No reagents -