HPA038690

LY6G5C antibody from Atlas Antibodies
C6orf20, G5c, NG33

Antibody data

Product number
HPA038690
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA038690, RRID:AB_10673286
Product name
Anti-LY6G5C
Provider product page
Atlas Antibodies - HPA038690
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
ADLPSCWGAGPCYTGHKVGALRRDTVICCCRHGDY
STPCLFTPGKPSRNPSPWKRTLWT
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.