PAB23329

LY6G5C antibody from Abnova Corporation
C6orf20, G5c, NG33

Antibody data

Product number
PAB23329
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#PAB23329, RRID:AB_11122111
Product name
LY6G5C polyclonal antibody
Provider product page
Abnova Corporation - PAB23329
Antibody type
Polyclonal
Description
Rabbit polyclonal antibody raised against recombinant LY6G5C.
Antigen sequence
ADLPSCWGAGPCYTGHKVGALRRDTVICCCRHGDY
STPCLFTPGKPSRNPSPWKRTLWT
Isotype
IgG
Storage
Store at 4°C. For long term storage store at -20°C.Aliquot to avoid repeated freezing and thawing.