Antibody data
- Antibody Data
- Antigen structure
- References [3]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- HPA040143 - Provider product page
- Provider
- Atlas Antibodies
- Proper citation
- Atlas Antibodies Cat#HPA040143, RRID:AB_10793916
- Product name
- Anti-IRG1
- Antibody type
- Polyclonal
- Description
- Affinity purified using the PrEST antigen as affinity ligand
- Reactivity
- Human
- Host
- Rabbit
- Conjugate
- Unconjugated
- Antigen sequence
FPAHLSTHWVADAAASVRKHLVAERALLPTDYIKR
IVLRIPNVQYVNRPFPVSEHEARHSFQYVACAMLL
DGGITVPSFHECQINRPQVRELLSKVELEY- Isotype
- IgG
- Vial size
- 100 µl
- Storage
- Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Submitted references Pro-inflammatory Macrophages Sustain Pyruvate Oxidation through Pyruvate Dehydrogenase for the Synthesis of Itaconate and to Enable Cytokine Expression
IFNs Modify the Proteome of Legionella-Containing Vacuoles and Restrict Infection Via IRG1-Derived Itaconic Acid
Gene Regulatory Network Inference of Immunoresponsive Gene 1 (IRG1) Identifies Interferon Regulatory Factor 1 (IRF1) as Its Transcriptional Regulator in Mammalian Macrophages
Meiser J, Krämer L, Sapcariu S, Battello N, Ghelfi J, D'Herouel A, Skupin A, Hiller K
Journal of Biological Chemistry 2016;291(8):3932-3946
Journal of Biological Chemistry 2016;291(8):3932-3946
IFNs Modify the Proteome of Legionella-Containing Vacuoles and Restrict Infection Via IRG1-Derived Itaconic Acid
Zamboni D, Naujoks J, Tabeling C, Dill B, Hoffmann C, Brown A, Kunze M, Kempa S, Peter A, Mollenkopf H, Dorhoi A, Kershaw O, Gruber A, Sander L, Witzenrath M, Herold S, Nerlich A, Hocke A, van Driel I, Suttorp N, Bedoui S, Hilbi H, Trost M, Opitz B
PLOS Pathogens 2016;12(2):e1005408
PLOS Pathogens 2016;12(2):e1005408
Gene Regulatory Network Inference of Immunoresponsive Gene 1 (IRG1) Identifies Interferon Regulatory Factor 1 (IRF1) as Its Transcriptional Regulator in Mammalian Macrophages
Passos G, Tallam A, Perumal T, Antony P, Jäger C, Fritz J, Vallar L, Balling R, del Sol A, Michelucci A
PLOS ONE 2016;11(2):e0149050
PLOS ONE 2016;11(2):e0149050
No comments: Submit comment
No validations: Submit validation data