HPA002858

SYP antibody from Atlas Antibodies
MRX96
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA002858
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA002858, RRID:AB_1080153
Product name
Anti-SYP
Provider product page
Atlas Antibodies - HPA002858
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
DMDVVNQLVAGGQFRVVKEPLGFVKVLQWAAPSVL
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -