Antibody data

Product number
HPA037553
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA037553, RRID:AB_10671375
Product name
Anti-MRPL47
Provider product page
Atlas Antibodies - HPA037553
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
LKERNMLLTLEQEAKRQRLPMPSPERLDKVVDSMD
ALDKVVQEREDALRLLQTGQERARPGAWRRDIFGR
IIWHKFKQWVI
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.