HPA002270

MGAM antibody from Sigma-Aldrich
MGA
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA002270
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA002270, RRID:AB_1079366
Product name
Anti-MGAM antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA002270
Antibody type
Polyclonal
Antigen
Maltase-glucoamylase, intestinal recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
VYLLCEFSVTQNRLEVNISQSTYKDPNNLAFNEIK
ILGTEEPSNVTVKHNGVPSQTSPTVTYDSNLKVAI
ITDIDLLLGEAYTVEWSIKIRDEEKIDCYPDENGA
SAENCTARGCIWEASNSSGVP
Storage
-20C
Provider Type Product Number
- No reagents -