HPA036943

BOD1L1 antibody from Atlas Antibodies
BOD1L, FAM44A, FLJ33215, KIAA1327
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA036943
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA036943, RRID:AB_2675397
Product name
Anti-BOD1L1
Provider product page
Atlas Antibodies - HPA036943
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
SDSMEEGEITSDDEEKNKQNKTKTQTSDSSEGKTK
SVRHAYVHKPYLYSKYYSDSDDELTVEQRRQSIGI
LWF
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -