HPA018406

MORC3 antibody from Sigma-Aldrich
KIAA0136, NXP2, ZCW5, ZCWCC3
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA018406
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA018406, RRID:AB_1858988
Product name
Anti-MORC3 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA018406
Antibody type
Polyclonal
Antigen
MORC family CW-type zinc finger protein 3 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
QETTDKSADDAGCQLQELRNQLLLVTEEKENYKRQ
CHMFTDQIKVLQQRILEMNDKYVKKETCHQSTETD
AVFLLESINGKSESPDHMVSQYQQALEEI
Storage
-20C
Provider Type Product Number
- No reagents -