HPA018406

MORC3 antibody from Atlas Antibodies
KIAA0136, NXP2, ZCW5, ZCWCC3

Antibody data

Product number
HPA018406
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA018406, RRID:AB_1858988
Product name
Anti-MORC3
Provider product page
Atlas Antibodies - HPA018406
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
QETTDKSADDAGCQLQELRNQLLLVTEEKENYKRQ
CHMFTDQIKVLQQRILEMNDKYVKKETCHQSTETD
AVFLLESINGKSESPDHMVSQYQQALEEI
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.