HPA025966

SLC10A5 antibody from Sigma-Aldrich
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA025966
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA025966, RRID:AB_1856959
Product name
Anti-SLC10A5 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA025966
Antibody type
Polyclonal
Antigen
Sodium/bile acid cotransporter 5 Precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
GETNVTIQLWDSEGRQERLIEEIKNVKVKVLKQKD
SLLQAPMHIDRNILMLILPLILLNKCAFGCKIEL
Storage
-20C
Provider Type Product Number
- No reagents -