Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [2]
- ELISA [1]
- Immunoprecipitation [1]
- Immunohistochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00140462-M01 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00140462-M01, RRID:AB_426132
- Product name
- ASB9 monoclonal antibody (M01), clone 1D8
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a full length recombinant ASB9.
- Antigen sequence
MDGKQGGMDGSKPAGPRDFPGIRLLSNPLMGDAVS
DWSPMHEAAIHGHQLSLRNLISQGWAVNIITADHV
SPLHEACLGGHLSCVKILLKHGAQVNGVTADWHTP
LFNACVSGSWDCVNLLLQHGASVQPESDLASPIHE
AARRAYGGNIDHKISHLGTPLYLACENQQRACVKK
LLESGADVNQGKGQDSPLHAVARTASEELACLLMD
FGADTQAKNAEGKRPVELVPPESPLAQLFLEREGA
SLPKPKP- Isotype
- IgG
- Antibody clone number
- 1D8
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references ASB9 interacts with ubiquitous mitochondrial creatine kinase and inhibits mitochondrial function.
Kwon S, Kim D, Rhee JW, Park JA, Kim DW, Kim DS, Lee Y, Kwon HJ
BMC biology 2010 Mar 19;8:23
BMC biology 2010 Mar 19;8:23
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- ASB9 monoclonal antibody (M01), clone 1D8 Western Blot analysis of ASB9 expression in HepG2 ( Cat # L019V1 ).
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Western Blot analysis of ASB9 expression in transfected 293T cell line by ASB9 monoclonal antibody (M01), clone 1D8.Lane 1: ASB9 transfected lysate(31.9 KDa).Lane 2: Non-transfected lysate.
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Detection limit for recombinant GST tagged ASB9 is approximately 0.1ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Immunoprecipitation of ASB9 transfected lysate using anti-ASB9 monoclonal antibody and Protein A Magnetic Bead (U0007), and immunoblotted with ASB9 MaxPab rabbit polyclonal antibody.
- Validation comment
- Immunoprecipitation
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Immunoperoxidase of monoclonal antibody to ASB9 on formalin-fixed paraffin-embedded human lymphoma tissue. [antibody concentration 3 ug/ml]
- Validation comment
- Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
- Protocol
- Protocol