HPA003060

ASB9 antibody from Atlas Antibodies
DKFZP564L0862, FLJ20636, MGC4954
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA003060
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA003060, RRID:AB_1078225
Product name
Anti-ASB9
Provider product page
Atlas Antibodies - HPA003060
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
SVQPESDLASPIHEAARRGHVECVNSLIAYGGNID
HKISHLGTPLYLACENQQRACVKKLLESGADVNQG
KGQDSPLHAVARTASEELACLLMDFGADTQAKNAE
GKRPVELVPPESPLAQLFLEREGA
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -