HPA003060

ASB9 antibody from Sigma-Aldrich
DKFZP564L0862, FLJ20636, MGC4954
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA003060
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA003060, RRID:AB_1078225
Product name
Anti-ASB9 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA003060
Antibody type
Polyclonal
Antigen
Ankyrin repeat and SOCS box protein 9 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
SVQPESDLASPIHEAARRGHVECVNSLIAYGGNID
HKISHLGTPLYLACENQQRACVKKLLESGADVNQG
KGQDSPLHAVARTASEELACLLMDFGADTQAKNAE
GKRPVELVPPESPLAQLFLEREGA
Storage
-20C
Provider Type Product Number
- No reagents -