Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Immunohistochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- PAB24267 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#PAB24267, RRID:AB_11118843
- Product name
- FAM168B polyclonal antibody
- Antibody type
- Polyclonal
- Description
- Rabbit polyclonal antibody raised against recombinant FAM168B.
- Antigen sequence
MNPVYSPGSSGVPYANAKGIGYPAGFPMGYAAAAP
AYSPNMYPGANPTFQTGYTPGTPYKVSCSPTSGAV
PPYSSSP- Isotype
- IgG
- Storage
- Store at 4°C. For long term storage store at -20°C.Aliquot to avoid repeated freezing and thawing.
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Immunohistochemical staining of human skeletal muscle with FAM168B polyclonal antibody (Cat # PAB24267) shows strong cytoplasmic and nuclear positivity in myocytes at 1:50-1:200 dilution.
- Validation comment
- Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)