Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Western blot [1]
- Immunohistochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- PAB24450 - Provider product page
- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#PAB24450, RRID:AB_11122365
- Product name
- C1orf94 polyclonal antibody
- Antibody type
- Polyclonal
- Antigen
- Recombinant protein corresponding to amino acids of human C1orf94.
- Reactivity
- Human
- Host
- Rabbit
- Antigen sequence
PAEKNLLYEFLGATKNPSGQPRLRNKVEVDGPELK
FNAPVTVADKNNPKYTGNVFTPHFPTAMTSATLNQ
PLWLNLNYPPPPV- Isotype
- IgG
- Vial size
- 100 μl
- Storage
- Store at 4°C. For long term storage store at -20°C.Aliquot to avoid repeated freezing and thawing.
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Western blot analysis of Lane 1: RT-4, Lane 2: U-251 MG, Lane 3: Human Plasma, Lane 4: Liver, Lane 5: Tonsil with C1orf94 polyclonal antibody (Cat # PAB24450) at 1:250-1:500 dilution.
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human uterus, pre-menopause with C1orf94 polyclonal antibody (Cat # PAB24450) shows strong cytoplasmic positivity in glandular cells at 1:20-1:50 dilution.
- Validation comment
- Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)