H00008266-M02A

UBL4A antibody from Abnova Corporation
DXS254E, GDX, GET5, MDY2, TMA24, UBL4

Antibody data

Product number
H00008266-M02A
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00008266-M02A, RRID:AB_1016959
Product name
UBL4A monoclonal antibody (M02A), clone 1C10
Provider product page
Abnova Corporation - H00008266-M02A
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a full-length recombinant UBL4A.
Antigen sequence
MQLTVKALQGRECSLQVPEDELVSTLKQLVSEKLN
VPVRQQRLLFKGKALADGKRLSDYSIGPNSKLNLV
VKPLEKVLLEEGEAQRLADSPPPQVWQLISKVLAR
HFSAADASRVLEQLQRDYERSLSRLTLDDIERLAS
RFLHPEVTETMEKGFSK
Isotype
IgM
Antibody clone number
1C10
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -