HPA003617

UBL4A antibody from Sigma-Aldrich
DXS254E, GDX, GET5, MDY2, TMA24, UBL4
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA003617
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA003617, RRID:AB_1080450
Product name
Anti-UBL4A antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA003617
Antibody type
Polyclonal
Antigen
Ubiquitin-like protein 4A recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
VSTLKQLVSEKLNVPVRQQRLLFKGKALADGKRLS
DYSIGPNSKLNLVVKPLEKVLLEEGEAQRLADSPP
PQVWQLISKVLARHFSAADASRVLEQLQRDYERSL
SRLTLDDIERLASRFLHPEVTETMEKG
Storage
-20C
Provider Type Product Number
- No reagents -