HPA037469

DNAH5 antibody from Atlas Antibodies
CILD3, Dnahc5, HL1, KTGNR, PCD

Antibody data

Product number
HPA037469
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA037469, RRID:AB_10672791
Product name
Anti-DNAH5
Provider product page
Atlas Antibodies - HPA037469
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
NFDTLTSSINARANALLLTTVTRKKKETEMLGEEA
RELLSHFNHQNMDALLKVTRNTLEAIRKRIHSSHT
INFRDSNSASNMKQNSLP
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.