PAB23114

DNAH5 antibody from Abnova Corporation
CILD3, Dnahc5, HL1, KTGNR, PCD

Antibody data

Product number
PAB23114
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#PAB23114, RRID:AB_11122748
Product name
DNAH5 polyclonal antibody
Provider product page
Abnova Corporation - PAB23114
Antibody type
Polyclonal
Description
Rabbit polyclonal antibody raised against recombinant DNAH5.
Antigen sequence
NFDTLTSSINARANALLLTTVTRKKKETEMLGEEA
RELLSHFNHQNMDALLKVTRNTLEAIRKRIHSSHT
INFRDSNSASNMKQNSLP
Isotype
IgG
Storage
Store at 4°C. For long term storage store at -20°C.Aliquot to avoid repeated freezing and thawing.