HPA006367

PCYT1B antibody from Sigma-Aldrich
CCT-beta, CTB
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA006367
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA006367, RRID:AB_1079585
Product name
Anti-PCYT1B antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA006367
Antibody type
Polyclonal
Antigen
Choline-phosphate cytidylyltransferase B recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
PVVTTDAESETGIPKSLSNEPPSETMEEIEHTCPQ
PRLTLTAPAPFADETNCQCQAPHEKLTIAQARLGT
PADRPVRVYADGIFDLFHSGHARALMQAKTLFPNS
YLLVGV
Storage
-20C
Provider Type Product Number
- No reagents -