Antibody data
- Antibody Data
- Antigen structure
- References [3]
- Comments [0]
- Validations
- Immunocytochemistry [1]
- Immunohistochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- HPA039408 - Provider product page
- Provider
- Atlas Antibodies
- Proper citation
- Atlas Antibodies Cat#HPA039408, RRID:AB_10795288
- Product name
- Anti-CEP152
- Antibody type
- Polyclonal
- Reactivity
- Human
- Host
- Rabbit
- Conjugate
- Unconjugated
- Antigen sequence
EGELNIELTESYVDLGIKKVNWKKSKVTSIVQEED
PNEELSKDEFILKLKAEVQRLLGSNSMKRHLVSQL
QNDLKDCHKKIEDLHQVKKDEKSIEVETKTDTSE- Isotype
- IgG
- Vial size
- 100 µl
- Storage
- Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Submitted references Mechanisms of HsSAS-6 assembly promoting centriole formation in human cells.
Resolution doubling in 3D-STORM imaging through improved buffers.
Simple buffers for 3D STORM microscopy.
Keller D, Orpinell M, Olivier N, Wachsmuth M, Mahen R, Wyss R, Hachet V, Ellenberg J, Manley S, Gönczy P
The Journal of cell biology 2014 Mar 3;204(5):697-712
The Journal of cell biology 2014 Mar 3;204(5):697-712
Resolution doubling in 3D-STORM imaging through improved buffers.
Olivier N, Keller D, Gönczy P, Manley S
PloS one 2013;8(7):e69004
PloS one 2013;8(7):e69004
Simple buffers for 3D STORM microscopy.
Olivier N, Keller D, Rajan VS, Gönczy P, Manley S
Biomedical optics express 2013 Jun 1;4(6):885-99
Biomedical optics express 2013 Jun 1;4(6):885-99
No comments: Submit comment
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunofluorescent staining of human cell line U-2 OS shows localization to nucleoplasm & centrosome.
- Sample type
- HUMAN
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human cerebellum shows strong cytoplasmic positivity in Purkinje cells.
- Sample type
- HUMAN