HPA023202

POLG2 antibody from Sigma-Aldrich
HP55, MTPOLB
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA023202
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA023202, RRID:AB_1855523
Product name
Anti-POLG2 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA023202
Antibody type
Polyclonal
Antigen
DNA polymerase subunit gamma-2, mitochondrial Precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
LDRGMLAYLYDSFQLTENSFTRKKNLHRKVLKLHP
CLAPIKVALDVGRGPTLELRQVCQGLFNELLENGI
SVWPGYLETMQSSLEQLYSKYDEMSILFTVLVTET
TLENGLIHLRSRDTTMKE
Storage
-20C
Provider Type Product Number
- No reagents -