HPA002949

DRP2 antibody from Sigma-Aldrich
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA002949
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA002949, RRID:AB_1078706
Product name
Anti-DRP2 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA002949
Antibody type
Polyclonal
Antigen
Dystrophin-related protein 2 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
SRIEHFASRLAEMESQNCSFFNDSLSPDDSIDEDQ
YLLRHSSPITDREPAFGQQAPCSVATESKGELQKI
LAHLEDENRILQGELRRLKWQHEEAAEAPSLADGS
TEAATDHRNEELLAEARILRQHKSRLETRMQILED
HNKQLESQ
Storage
-20C
Provider Type Product Number
- No reagents -