Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN504126 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-Chromosome X Open Reading Frame 26 (CXorf26) (Middle Region) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-CXorf26 antibody: synthetic peptide directed towards the middle region of human CXorf26
- Description
- Affinity Purified
- Reactivity
- Human, Mouse, Rat
- Host
- Rabbit
- Antigen sequence
IYSEFRKNFETLRIDVLDPEELKSESAKEKWRPFC
LKFNG IVEDFNYGTL- Epitope
- Middle Region
- Vial size
- 50 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references Transcriptional maps of 10 human chromosomes at 5-nucleotide resolution.
Cheng J, Kapranov P, Drenkow J, Dike S, Brubaker S, Patel S, Long J, Stern D, Tammana H, Helt G, Sementchenko V, Piccolboni A, Bekiranov S, Bailey DK, Ganesh M, Ghosh S, Bell I, Gerhard DS, Gingeras TR
Science (New York, N.Y.) 2005 May 20;308(5725):1149-54
Science (New York, N.Y.) 2005 May 20;308(5725):1149-54
No comments: Submit comment
No validations: Submit validation data