HPA003155

PBDC1 antibody from Sigma-Aldrich
CXorf26, MGC874
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA003155
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA003155, RRID:AB_1078592
Product name
Anti-CXorf26 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA003155
Antibody type
Polyclonal
Antigen
UPF0368 protein Cxorf26 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
EVYYKLISSVDPQFLKLTKVDDQIYSEFRKNFETL
RIDVLDPEELKSESAKEKWRPFCLKFNGIVEDFNY
GTLLRLDCSQGYTEENTIFAPRIQFFAIEIARNRE
GYNKAVYISVQDKEGEKGVNNGGEKRADSGEEENT
KNGGEK
Storage
-20C
Provider Type Product Number
- No reagents -