Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Western blot [1]
- ELISA [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00051296-M04 - Provider product page 
- Provider
- Abnova Corporation
- Product name
- SLC15A3 monoclonal antibody (M04), clone 5B4
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant SLC15A3.
- Antigen sequence
- KPPMGSQVSSMLKLALQNCCPQLWQRHSARDRQCA
 RVLADERSPQPGASPQEDIANFQ
- Isotype
- IgG
- Antibody clone number
- 5B4
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
				No comments: Submit comment	
	
			
							
					Supportive validation
					
									
				
				- Submitted by
- Abnova Corporation (provider)
- Main image
 
- Experimental details
- SLC15A3 monoclonal antibody (M04), clone 5B4. Western Blot analysis of SLC15A3 expression in PC-12.
							
					Supportive validation
					
									
				
		- Submitted by
- Abnova Corporation (provider)
- Main image
 
- Experimental details
- Detection limit for recombinant GST tagged SLC15A3 is 0.3 ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol