HPA002950

TEX11 antibody from Sigma-Aldrich
TGC1, TSGA3
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA002950
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA002950, RRID:AB_1080249
Product name
Anti-TEX11 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA002950
Antibody type
Polyclonal
Antigen
Testis expressed sequence 11 isoform 1 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
LEQGRKASTAFEQTMFLSRALEEIQTCNDIHNFLK
QTGTFSNDSCEKLLLLYEFEVRAKLNDPLLESFLE
SVWELPHLETKTFETIAIIAMEKPAHYPLIALKAL
KKALLLYKKEEPIDISQYSKCMHNLV
Storage
-20C
Provider Type Product Number
- No reagents -